Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EARS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | EARS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15640020
|
Novus Biologicals
NBP15640020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156400
|
Novus Biologicals
NBP156400 |
100 μL |
Each for $487.50
|
|
|||||
Description
EARS2 Polyclonal specifically detects EARS2 in Human samples. It is validated for Western Blot.Specifications
| EARS2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| EC 6.1.1.17, GluRS, Glutamate--tRNA ligase, glutamyl-tRNA synthetase 2, mitochondrial (putative), KIAA1970glutamate tRNA ligase 2, mitochondrial, MSE1, probable glutamyl-tRNA synthetase, mitochondrial | |
| EARS2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q86YH3 | |
| 124454 | |
| Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title