Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EARS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15640020UL
Description
EARS2 Polyclonal specifically detects EARS2 in Human samples. It is validated for Western Blot.Specifications
EARS2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q86YH3 | |
EARS2 | |
Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL. | |
20 μL | |
Lipid and Metabolism | |
124454 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 6.1.1.17, GluRS, Glutamate--tRNA ligase, glutamyl-tRNA synthetase 2, mitochondrial (putative), KIAA1970glutamate tRNA ligase 2, mitochondrial, MSE1, probable glutamyl-tRNA synthetase, mitochondrial | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction