Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EBAG9/RCAS1 Antibody, Novus Biologicals™

EBAG9/RCAS1 Antibody, Novus Biologicals™
SDP

Catalog No. NB432435 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB432435 25ul
NBP184923 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB432435 Supplier Novus Biologicals Supplier No. NBP18492325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

EBAG9/RCAS1 Polyclonal specifically detects EBAG9/RCAS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen EBAG9/RCAS1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Cancer-associated surface antigen RCAS1, EB9cancer associated surface antigen, estrogen receptor binding site associated, antigen, 9, Estrogen receptor-binding fragment-associated gene 9 protein, RCAS1PDAF, receptor-binding cancer antigen expressed on SiSo cells
Gene Symbols EBAG9
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 9166
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.