EBAG9/RCAS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184923

Catalog No. NBP184923

Description

EBAG9/RCAS1 Polyclonal specifically detects EBAG9/RCAS1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EBAG9/RCAS1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Cancer-associated surface antigen RCAS1, EB9cancer associated surface antigen, estrogen receptor binding site associated, antigen, 9, Estrogen receptor-binding fragment-associated gene 9 protein, RCAS1PDAF, receptor-binding cancer antigen expressed on SiSo cells
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: EBAG9
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 9166
• Target Species: Human
• Isotype: IgG

For Research Use Only