EBF-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179982

Catalog No. NBP179982

Description

EBF-3 Polyclonal specifically detects EBF-3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EBF-3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COE3OE-2, DKFZp667B0210, early B-cell factor 3O/E-2, EBF-3, Olf-1/EBF-like 2, transcription factor COE3
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001005463
• Gene Symbols: EBF3
• Immunogen: Synthetic peptide directed towards the middle region of human EBF3. Peptide sequence AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 253738
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified