Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EBF-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17998220UL
Description
EBF-3 Polyclonal specifically detects EBF-3 in Human samples. It is validated for Western Blot.Specifications
EBF-3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001005463 | |
EBF3 | |
Synthetic peptide directed towards the middle region of human EBF3. Peptide sequence AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ. | |
Protein A purified | |
RUO | |
253738 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
COE3OE-2, DKFZp667B0210, early B-cell factor 3O/E-2, EBF-3, Olf-1/EBF-like 2, transcription factor COE3 | |
Rabbit | |
60 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction