Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EBF-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | EBF-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17998220
|
Novus Biologicals
NBP17998220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179982
|
Novus Biologicals
NBP179982 |
100 μL |
Each for $487.50
|
|
|||||
Description
EBF-3 Polyclonal specifically detects EBF-3 in Human samples. It is validated for Western Blot.Specifications
| EBF-3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| COE3OE-2, DKFZp667B0210, early B-cell factor 3O/E-2, EBF-3, Olf-1/EBF-like 2, transcription factor COE3 | |
| EBF3 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_001005463 | |
| 253738 | |
| Synthetic peptide directed towards the middle region of human EBF3. Peptide sequence AHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQ. | |
| Primary | |
| 60 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title