ECE-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169061

Catalog No. NBP169061

Description

ECE-2 Polyclonal specifically detects ECE-2 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: ECE-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.4.24, EC 3.4.24.71, ECE-2, endothelin converting enzyme 2, endothelin-converting enzyme 2, KIAA0604MGC2408, MGC17664, MGC78487
• Host Species: Rabbit
• Molecular Weight of Antigen: 86 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6IE65
• Gene Symbols: ECE2
• Immunogen: Synthetic peptides corresponding to Ece2 (endothelin-converting enzyme 2) The peptide sequence was selected from the middle region of Ece2. Peptide sequence YMVELGMLLGGQPTSTRAQMQQVLELEIQLATITVPQDQRRDEEKIYHKM.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9718
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG