Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ECE-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ECE-2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ECE-2 Polyclonal specifically detects ECE-2 in Rat samples. It is validated for Western Blot.Specifications
ECE-2 | |
Polyclonal | |
Rabbit | |
Q6IE65 | |
9718 | |
Synthetic peptides corresponding to Ece2 (endothelin-converting enzyme 2) The peptide sequence was selected from the middle region of Ece2. Peptide sequence YMVELGMLLGGQPTSTRAQMQQVLELEIQLATITVPQDQRRDEEKIYHKM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 3.4.24, EC 3.4.24.71, ECE-2, endothelin converting enzyme 2, endothelin-converting enzyme 2, KIAA0604MGC2408, MGC17664, MGC78487 | |
ECE2 | |
IgG | |
86 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title