ECHDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179302

Catalog No. NBP179302

Description

ECHDC3 Polyclonal specifically detects ECHDC3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ECHDC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: enoyl CoA hydratase domain containing 3, enoyl Coenzyme A hydratase domain containing 3, FLJ20909, mitochondrial
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79746
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: EAW86340
• Gene Symbols: ECHDC3
• Immunogen: Synthetic peptide directed towards the N terminal of human ECHDC3The immunogen for this antibody is ECHDC3. Peptide sequence SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Chicken: 92%; Xenopus: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Form: Purified