EDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25711525UL

Catalog No. NB394128

Description

EDC3 Polyclonal specifically detects EDC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: EDC3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: enhancer of mRNA decapping 3 homolog (S. cerevisiae), enhancer of mRNA-decapping protein 3, FLJ21128, FLJ31777, hYjeF_N2, hYjeF_N2-15q23, LSM16, LSM16 homolog, LSM16 homolog (EDC3, S. cerevisiae), YJDC, yjeF domain containing, YjeF domain-containing protein 1, YjeF N-terminal domain-containing protein 2, YjeF_N2, YJEFN2yjeF domain containing (E.coli)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 80153
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EDC3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only