Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | EDC3 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
EDC3 Polyclonal specifically detects EDC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
EDC3 | |
Polyclonal | |
Rabbit | |
Human | |
enhancer of mRNA decapping 3 homolog (S. cerevisiae), enhancer of mRNA-decapping protein 3, FLJ21128, FLJ31777, hYjeF_N2, hYjeF_N2-15q23, LSM16, LSM16 homolog, LSM16 homolog (EDC3, S. cerevisiae), YJDC, yjeF domain containing, YjeF domain-containing protein 1, YjeF N-terminal domain-containing protein 2, YjeF_N2, YJEFN2yjeF domain containing (E.coli) | |
EDC3 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
80153 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title