Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301643

EDIL3/DEL1 Antibody, Novus Biologicals™
SDP

Catalog No. NB301643 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301643 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301643 Supplier Novus Biologicals Supplier No. NBP324809
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

EDIL3/DEL1 Polyclonal antibody specifically detects EDIL3/DEL1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen EDIL3/DEL1
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias DEL1developmental endothelial locus-1, Developmentally-regulated endothelial cell locus 1 protein, EGF-like repeat and discoidin I-like domain-containing protein 3, EGF-like repeats and discoidin I-like domains 3, Integrin-binding protein DEL1, MGC26287
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein EDIL3/DEL1 using the following amino acid sequence: QRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCEL
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 10085
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.