eEF1A2 binding protein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24896225UL

Catalog No. NB395912

Description

eEF1A2 binding protein Polyclonal antibody specifically detects eEF1A2 binding protein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: eEF1A2 binding protein
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: DKFZp434B1231, eEF1A2 binding protein, EEF1A2-binding protein 1, EEF1A2BP1, immunoglobulin-like and fibronectin type III domain containing 1, immunoglobulin-like and fibronectin type III domain-containing protein 1, KY-interacting protein 1, KYIP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AHSFRIRVAACPQAPGPIHLQENVPGTVTAEWEPSPDEAQDVPLHYAVFTRSSAHGPWHEAADRIYTNRFTLLGILPGHEYHFRVVA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91156
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG