Eg5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258929

Catalog No. NBP258929

Description

Eg5 Polyclonal specifically detects Eg5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Eg5
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Eg5, HKSP, kinesin family member 11, kinesin-like 1, Kinesin-like protein 1, kinesin-like protein KIF11, Kinesin-like spindle protein HKSP, Kinesin-related motor protein Eg5, KNSL1TRIP-5, thyroid receptor interacting protein 5, Thyroid receptor-interacting protein 5, TR-interacting protein 5, TRIP5EG5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: KIF11
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Cytoskeleton Markers, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 3832
• Target Species: Human
• Isotype: IgG

For Research Use Only