Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Eg5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Eg5 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Eg5 Polyclonal specifically detects Eg5 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Eg5 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Cytoskeleton Markers, Signal Transduction, Stem Cell Markers | |
Eg5, HKSP, kinesin family member 11, kinesin-like 1, Kinesin-like protein 1, kinesin-like protein KIF11, Kinesin-like spindle protein HKSP, Kinesin-related motor protein Eg5, KNSL1TRIP-5, thyroid receptor interacting protein 5, Thyroid receptor-interacting protein 5, TR-interacting protein 5, TRIP5EG5 | |
KIF11 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
3832 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title