Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EGLN2/PHD1 Antibody, Novus Biologicals™
SDP

Catalog No. NB392743 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392743 25 μL
NBP276551 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB392743 Supplier Novus Biologicals Supplier No. NBP27655125UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

EGLN2/PHD1 Polyclonal specifically detects EGLN2/PHD1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen EGLN2/PHD1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Accession No. Q96KS0
Gene Alias DKFZp434E026, EC 1.14.11, EC 1.14.11.-, egl nine homolog 2, egl nine homolog 2 (C. elegans), EIT6, Estrogen-induced tag 6, FLJ95603, HIF-PH1, HIFPH1 EGL nine (C.elegans) homolog 2, HIF-prolyl hydroxylase 1, HPH-1, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 1, PHD1, Prolyl hydroxylase domain-containing protein 1
Gene Symbols EGLN2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 112398
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.