Learn More
Description
Specifications
Specifications
| Antigen | EHHADH |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase, enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase, LBFP, LBP, L-PBE, PBFEMGC120586, peroxisomal, peroxisomal bifunctional enzyme3,2-trans-enoyl-CoA isomerase, peroxisomal enoyl-CoA hydratase |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKE |
| Purification Method | Immunogen affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
