Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EIF2AK1 Antibody, Novus Biologicals™

EIF2AK1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156484 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156484 100 μL
NBP15648420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP156484 Supplier Novus Biologicals Supplier No. NBP156484
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

EIF2AK1 Polyclonal specifically detects EIF2AK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen EIF2AK1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BQI3
Gene Alias EC 2.7.11, eukaryotic translation initiation factor 2-alpha kinase 1, HCR, heme sensitive initiation factor 2a kinase, Heme-controlled repressor, Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase, Heme-regulated inhibitor, heme-regulated initiation factor 2-alpha kinase, heme-regulated repressor, Hemin-sensitive initiation factor 2-alpha kinase, HRIEC 2.7.11.1, KIAA1369heme regulated initiation factor 2 alpha kinase
Gene Symbols EIF2AK1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to EIF2AK1(eukaryotic translation initiation factor 2-alpha kinase 1) The peptide sequence was selected from the N terminal of EIF2AK1. Peptide sequence TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 27102
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 78%; Chicken: 76%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.