Learn More
Description
Specifications
Specifications
| Antigen | EIF3C |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Accession No. | Q99613 |
| Gene Alias | cell migration-inducing protein 17, eIF3 p110, eIF3c, EIF3CL, eIF3-p110, EIF3S8FLJ55450, Eukaryotic translation initiation factor 3 subunit 8, eukaryotic translation initiation factor 3 subunit C, eukaryotic translation initiation factor 3, subunit 8 (110kD), eukaryotic translation initiation factor 3, subunit 8, 110kDa, eukaryotic translation initiation factor 3, subunit C, FLJ53378, FLJ54400, FLJ54404, FLJ55750, FLJ78287, MGC189737, MGC189744 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
