Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EIF3C Antibody, Novus Biologicals™

EIF3C Antibody, Novus Biologicals™
SDP

Catalog No. NB396324 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396324 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396324 Supplier Novus Biologicals Supplier No. NBP24678425UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

EIF3C Polyclonal antibody specifically detects EIF3C in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen EIF3C
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. Q99613
Gene Alias cell migration-inducing protein 17, eIF3 p110, eIF3c, EIF3CL, eIF3-p110, EIF3S8FLJ55450, Eukaryotic translation initiation factor 3 subunit 8, eukaryotic translation initiation factor 3 subunit C, eukaryotic translation initiation factor 3, subunit 8 (110kD), eukaryotic translation initiation factor 3, subunit 8, 110kDa, eukaryotic translation initiation factor 3, subunit C, FLJ53378, FLJ54400, FLJ54404, FLJ55750, FLJ78287, MGC189737, MGC189744
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NELMDILFANPNIFVGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRYLEEKGTTE
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8663
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.