Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EIF3G Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

EIF3G Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125975 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125975 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125975 Supplier Novus Biologicals Supplier No. NBP310537100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

EIF3G Polyclonal specifically detects EIF3G in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation.

Specifications

Antigen EIF3G
Applications Western Blot, Immunohistochemistry, Immunoprecipitation
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation
Formulation PBS buffer, 2% sucrose
Gene Alias eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EIF3G (NP_003746). Peptide sequence LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8666
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.