Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF3G Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | EIF3G |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation |
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
EIF3G Polyclonal specifically detects EIF3G in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation.Specifications
| EIF3G | |
| Western Blot, Immunohistochemistry, Immunoprecipitation | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| eIF3 p42, eIF3 p44, eIF-3-delta, eIF3-delta, eIF3g, EIF3-P42, eIF3-p44, EIF3S4eIF-3 RNA-binding subunit, Eukaryotic translation initiation factor 3 RNA-binding subunit, Eukaryotic translation initiation factor 3 subunit 4, eukaryotic translation initiation factor 3 subunit G, eukaryotic translation initiation factor 3 subunit p42, eukaryotic translation initiation factor 3, subunit 4 (delta, 44kD), eukaryotic translation initiation factor 3, subunit 4 delta, 44kDa, eukaryotic translation initiation factor 3, subunit G | |
| The immunogen is a synthetic peptide directed towards the middle region of human EIF3G (NP_003746). Peptide sequence LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunoprecipitation | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 8666 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title