Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF3S3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | EIF3S3 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
EIF3S3 Polyclonal specifically detects EIF3S3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
EIF3S3 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
eIF-3-gamma, eIF3-gamma, eIF3h, eIF3-p40, EIF3S3eIF3 p40 subunit, Eukaryotic translation initiation factor 3 subunit 3, eukaryotic translation initiation factor 3 subunit H, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD), eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa, eukaryotic translation initiation factor 3, subunit H, MGC102958 | |
EIF3H | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
Polyclonal | |
Rabbit | |
Angiogenesis, Cancer | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
8667 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title