Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. EIF4A3 Antibody, Novus Biologicals™

EIF4A3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15734220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15734220 20 μL
NBP157342 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15734220 Supplier Novus Biologicals Supplier No. NBP15734220UL

Description

Rabbit Polyclonal Antibody

EIF4A3 Polyclonal specifically detects EIF4A3 in Human samples. It is validated for Western Blot.

Specifications

Antigen EIF4A3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P38919
Gene Alias ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF-4A-III, eIF4A-III, EIF4AIII, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
Gene Symbols EIF4A3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9775
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.