Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EIF4E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31783925UL
This item is not returnable.
View return policy
Description
EIF4E2 Polyclonal antibody specifically detects EIF4E2 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
EIF4E2 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
4EHP, 4E-LP, eIF4E type 2, eIF-4E type 2, EIF4EL3, eIF4E-like cap-binding protein, eIF4E-like protein 4E-LP, eukaryotic translation initiation factor 4E family member 2, Eukaryotic translation initiation factor 4E homologous protein, eukaryotic translation initiation factor 4E member 2, eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-like 34E-LP, IF4e, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT | |
25 μg | |
DNA Repair, DNA replication Transcription Translation and Splicing | |
9470 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction