Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EIF4E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$343.50 - $573.00

Specifications

Antigen	EIF4E2
Dilution	Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Applications	Western Blot, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB159709 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31783925UL	25 μg	Each for $343.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB159708 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP317839100UL	100 μg	Each for $573.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

EIF4E2 Polyclonal antibody specifically detects EIF4E2 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen	EIF4E2
Applications	Western Blot, Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	DNA Repair, DNA replication Transcription Translation and Splicing
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	9470
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	4EHP, 4E-LP, eIF4E type 2, eIF-4E type 2, EIF4EL3, eIF4E-like cap-binding protein, eIF4E-like protein 4E-LP, eukaryotic translation initiation factor 4E family member 2, Eukaryotic translation initiation factor 4E homologous protein, eukaryotic translation initiation factor 4E member 2, eukaryotic translation initiation factor 4E type 2, Eukaryotic translation initiation factor 4E-like 34E-LP, IF4e, mRNA cap-binding protein 4EHP, mRNA cap-binding protein type 3
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: LRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

EIF4E2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents