Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELA3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25472525UL
Description
ELA3A Polyclonal specifically detects ELA3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ELA3A | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| chymotrypsin-like elastase family member 3A, chymotrypsin-like elastase family, member 3A, EC 3.4.21, EC 3.4.21.70, ELA3A, ELA3elastase 1, elastase 3A, pancreatic, elastase 3A, pancreatic (protease E), Elastase IIIA, elastase-3A, Protease E | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CELA3A | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL | |
| 25 μL | |
| Lipid and Metabolism | |
| 10136 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction