Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELA3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	ELA3A
Dilution	Immunohistochemistry-Paraffin 1:200 - 1:500
Applications	Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP254725 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP254725	100 μL	Each for $610.00	Only null left	Sign In or Register to check your price. Add to Cart

NB404095 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25472525UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

ELA3A Polyclonal specifically detects ELA3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ELA3A
Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	chymotrypsin-like elastase family member 3A, chymotrypsin-like elastase family, member 3A, EC 3.4.21, EC 3.4.21.70, ELA3A, ELA3elastase 1, elastase 3A, pancreatic, elastase 3A, pancreatic (protease E), Elastase IIIA, elastase-3A, Protease E
Gene Symbols	CELA3A
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Immunohistochemistry-Paraffin 1:200 - 1:500
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	10136
Immunogen	This antibody was developed against a Recombinant Protein corresponding to amino acids:LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ELA3A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents