ELF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24964625UL

Catalog No. NB395576

Description

ELF2 Polyclonal antibody specifically detects ELF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ELF2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: b, E74-like factor 2, E74-like factor 2 (ets domain transcription factor), ets family transcription factor ELF2C, ETS-related transcription factor Elf-2, NERF-1A, NERF-1B, NERF-2, NERFEU32, New ETS-related factor
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1998
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG