Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ELFN2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP19056925UL
Description
ELFN2 Polyclonal specifically detects ELFN2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ELFN2 | |
Polyclonal | |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
dJ63G5.3, dJ63G5.3 (putative Leucine rich protein), ELFN2, extracellular leucine-rich repeat and fibronectin type III containing 2, extracellular leucine-rich repeat and fibronectin type III domain containing 2, extracellular leucine-rich repeat and fibronectin type III domain-containing protein 2, KIAA1904, leucine rich repeat containing 62, leucine-rich repeat and fibronectin type-III domain-containing protein 6, leucine-rich repeat-containing protein 62, LRRC62, protein phosphatase 1, regulatory subunit 29 | |
Rabbit | |
Affinity Purified | |
RUO | |
114794 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ELFN2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction