ELOVL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233500

Catalog No. NBP233500

Description

ELOVL5 Polyclonal specifically detects ELOVL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ELOVL5
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9NYP7
• Gene Symbols: ELOVL5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
• Quantity: 0.1 mL
• Research Discipline: Cardiovascular Biology, Cellular Signaling
• Gene ID (Entrez): 60481
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only