Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ELTD1/ETL Antibody (CL4164), Novus Biologicals™
SDP

Catalog No. NB403057 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403057 25 μL
NBP259041 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403057 Supplier Novus Biologicals Supplier No. NBP25904125UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

ELTD1/ETL Monoclonal specifically detects ELTD1/ETL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ELTD1/ETL
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EGF, latrophilin and seven transmembrane domain containing 1, EGF, latrophilin and seven transmembrane domain-containing protein 1, ETL protein, ETLEGF-TM7-latrophilin-related protein, KPG_003
Gene Symbols ADGRL4
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTVCIENVNANCHLDNVCIAANINKTLTKIRSIKEPVALLQEVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTIS
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline GPCR, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 64123
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.