Learn More
Description
Specifications
Specifications
| Antigen | EMG1 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1, BWCNS, C2F18S rRNA Psi1248 methyltransferase, EMG1 nucleolar protein homolog (S. cerevisiae), essential for mitotic growth 1, FLJ60792, Grcc2f, NEP1EC 2.1.1.-, Nucleolar protein EMG1 homolog, probable ribosome biogenesis protein NEP1, Protein C2f, Ribosome biogenesis protein NEP1 |
| Gene Symbols | EMG1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids:SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
