Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EMG1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP254688 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP254688 100 μL
NB395301 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP254688 Supplier Novus Biologicals Supplier No. NBP254688
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

EMG1 Polyclonal specifically detects EMG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen EMG1
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1, BWCNS, C2F18S rRNA Psi1248 methyltransferase, EMG1 nucleolar protein homolog (S. cerevisiae), essential for mitotic growth 1, FLJ60792, Grcc2f, NEP1EC 2.1.1.-, Nucleolar protein EMG1 homolog, probable ribosome biogenesis protein NEP1, Protein C2f, Ribosome biogenesis protein NEP1
Gene Symbols EMG1
Host Species Rabbit
Immunogen This antibody was developed against a Recombinant Protein corresponding to amino acids:SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW
Purification Method Immunogen affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 10436
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.