Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EMI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15505020UL
Description
EMI1 Polyclonal specifically detects EMI1 in Human samples. It is validated for Western Blot.Specifications
| EMI1 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9UKT4 | |
| FBXO5 | |
| Synthetic peptides corresponding to FBXO5(F-box protein 5) The peptide sequence was selected from the C terminal of FBXO5. Peptide sequence ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL. | |
| Affinity Purified | |
| RUO | |
| 26271 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| EMI1Early mitotic inhibitor 1, F-box only protein 5, F-box protein 5, FBX5F-box protein Fbx5, Fbxo31 | |
| Rabbit | |
| 50 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction