EMID1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162472

Catalog No. NBP162472

Description

EMID1 Polyclonal specifically detects EMID1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EMID1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EMI domain containing 1, EMI5, Emilin and multimerin domain-containing protein 1, emilin and multimerin-domain containing protein 1, Emu1, EMU1EMI domain-containing protein 1, hEmu1, MGC50657, putative emu1
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96A84
• Gene Symbols: EMID1
• Immunogen: Synthetic peptides corresponding to EMID1(EMI domain containing 1) The peptide sequence was selected from the C terminal of EMID1. Peptide sequence TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 129080
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG