Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EML1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15659520UL
Description
EML1 Polyclonal specifically detects EML1 in Human samples. It is validated for Western Blot.Specifications
EML1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O00423 | |
EML1 | |
Synthetic peptides corresponding to EML1(echinoderm microtubule associated protein like 1) The peptide sequence was selected from the C terminal of EML1. Peptide sequence YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
echinoderm microtubule associated protein like 1, ELP79, EMAP1, EMAP-1, EMAPechinoderm microtubule-associated protein-like 1, EMAPL1, EMAPLhuEMAP-1, FLJ45033, HuEMAP, HuEMAP-1 | |
Rabbit | |
Affinity Purified | |
RUO | |
2009 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction