Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    EML1 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15659520UL
Description
EML1 Polyclonal specifically detects EML1 in Human samples. It is validated for Western Blot.Specifications
| EML1 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| O00423 | |
| EML1 | |
| Synthetic peptides corresponding to EML1(echinoderm microtubule associated protein like 1) The peptide sequence was selected from the C terminal of EML1. Peptide sequence YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG | 
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| echinoderm microtubule associated protein like 1, ELP79, EMAP1, EMAP-1, EMAPechinoderm microtubule-associated protein-like 1, EMAPL1, EMAPLhuEMAP-1, FLJ45033, HuEMAP, HuEMAP-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 2009 | |
| Store at -20C. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction