Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EML1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	EML1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15659520 View Documents View Product Certificates	Novus Biologicals NBP15659520UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP156595 View Documents View Product Certificates	Novus Biologicals NBP156595	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

EML1 Polyclonal specifically detects EML1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	EML1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	O00423
Gene ID (Entrez)	2009
Immunogen	Synthetic peptides corresponding to EML1(echinoderm microtubule associated protein like 1) The peptide sequence was selected from the C terminal of EML1. Peptide sequence YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	echinoderm microtubule associated protein like 1, ELP79, EMAP1, EMAP-1, EMAPechinoderm microtubule-associated protein-like 1, EMAPL1, EMAPLhuEMAP-1, FLJ45033, HuEMAP, HuEMAP-1
Gene Symbols	EML1
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

EML1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents