Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
EML3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | EML3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17959620
![]() |
Novus Biologicals
NBP17959620UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179596
![]() |
Novus Biologicals
NBP179596 |
100 μL |
Each for $487.50
|
|
|||||
Description
EML3 Polyclonal specifically detects EML3 in Human samples. It is validated for Western Blot.Specifications
EML3 | |
Polyclonal | |
Rabbit | |
NP_694997 | |
256364 | |
Synthetic peptide directed towards the N terminal of human EML3The immunogen for this antibody is EML3. Peptide sequence LLVRSGSTESRGGKDPLSSPGGPGSRRSNYNLEGISVKMFLRGRPITMYI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
echinoderm microtubule associated protein like 3 | |
EML3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title