Endophilin A1/SH3GL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179628

Catalog No. NBP179628

Description

Endophilin A1/SH3GL2 Polyclonal specifically detects Endophilin A1/SH3GL2 in Human, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Endophilin A1/SH3GL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 78%.
• Target Species: Human, Rat, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003017
• Gene Symbols: SH3GL2
• Immunogen: Synthetic peptide directed towards the N terminal of human SH3GL2The immunogen for this antibody is SH3GL2. Peptide sequence INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA.
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 6456
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.