Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Endophilin A1/SH3GL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Endophilin A1/SH3GL2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Endophilin A1/SH3GL2 Polyclonal specifically detects Endophilin A1/SH3GL2 in Human, Rat samples. It is validated for Western Blot.Specifications
Endophilin A1/SH3GL2 | |
Polyclonal | |
Rabbit | |
NP_003017 | |
6456 | |
Synthetic peptide directed towards the N terminal of human SH3GL2The immunogen for this antibody is SH3GL2. Peptide sequence INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1 | |
SH3GL2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title