engrailed homeobox 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310900100UL

Catalog No. NB126701

Description

engrailed homeobox 2 Polyclonal specifically detects engrailed homeobox 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: engrailed homeobox 2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: AUTS10, engrailed homeobox 2, engrailed homolog 2, engrailed-2, Homeobox protein en-2, homeobox protein engrailed-2, hu-En-2
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human engrailed homeobox 2 (NP_001418). Peptide sequence NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2020
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.