Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. engrailed homeobox 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

engrailed homeobox 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB126701 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB126701 100 μg
NB126702 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB126701 Supplier Novus Biologicals Supplier No. NBP310900100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

engrailed homeobox 2 Polyclonal specifically detects engrailed homeobox 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen engrailed homeobox 2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS buffer, 2% sucrose
Gene Alias AUTS10, engrailed homeobox 2, engrailed homolog 2, engrailed-2, Homeobox protein en-2, homeobox protein engrailed-2, hu-En-2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human engrailed homeobox 2 (NP_001418). Peptide sequence NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2020
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.