ENOSF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156422

Catalog No. NBP156422

Description

ENOSF1 Polyclonal specifically detects ENOSF1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ENOSF1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Antisense RNA to thymidylate synthase, EC 5.-, enolase superfamily member 1, HSRTSBETA, rTS, rTS beta, RTSrTS alpha, TYMSASmitochondrial enolase superfamily member 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55556
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7L5Y1
• Gene Symbols: ENOSF1
• Immunogen: Synthetic peptides corresponding to ENOSF1(enolase superfamily member 1) The peptide sequence was selected from the N terminal of ENOSF1. Peptide sequence MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 84%.
• Target Species: Human, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG