Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ENOSF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ENOSF1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ENOSF1 Polyclonal specifically detects ENOSF1 in Human samples. It is validated for Western Blot.Specifications
ENOSF1 | |
Polyclonal | |
Rabbit | |
Q7L5Y1 | |
55556 | |
Synthetic peptides corresponding to ENOSF1(enolase superfamily member 1) The peptide sequence was selected from the N terminal of ENOSF1. Peptide sequence MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Antisense RNA to thymidylate synthase, EC 5.-, enolase superfamily member 1, HSRTSBETA, rTS, rTS beta, RTSrTS alpha, TYMSASmitochondrial enolase superfamily member 1 | |
ENOSF1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title