ENTHD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324817

Catalog No. NB301635

Description

ENTHD2 Polyclonal antibody specifically detects ENTHD2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: ENTHD2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: AP-4 Accessory Protein, AP-4 Complex Accessory Subunit Tepsin, C17orf56, Chromosome 17 Open Reading Frame 56, ENTH Domain Containing 2, ENTH Domain-Containing Protein 2, Epsin For AP-4, TEPSIN, TEPSIN, Adaptor Related Protein Complex 4 Accessory Protein, Tetra-Epsin
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ENTHD2 using the following amino acid sequence: SECTQLRALCAIASLGSSDLLPQEHILLRTRPWLQELSMGSPGPVTNKATKILRHFEASCGQLSPARGTSAEPGPTAALPGPSDLLTDAVPLPGSQVFLQPLSSTPVSSRSPAPSSGMP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 146705
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG