ENTHD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255976

Catalog No. NBP255976

Description

ENTHD2 Polyclonal specifically detects ENTHD2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ENTHD2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AP-4 Accessory Protein, AP-4 Complex Accessory Subunit Tepsin, C17orf56, Chromosome 17 Open Reading Frame 56, ENTH Domain Containing 2, ENTH Domain-Containing Protein 2, Epsin For AP-4, TEPSIN, TEPSIN, Adaptor Related Protein Complex 4 Accessory Protein, Tetra-Epsin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 146705
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ENTHD2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKLKVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVR
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only