Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EPB41 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155096

 View more versions of this product

Catalog No. NBP155096


Add to cart

Description

Description

EPB41 Polyclonal antibody specifically detects EPB41 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot.
Specifications

Specifications

EPB41
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
EPB41
Synthetic peptides corresponding to EPB41(erythrocyte membrane protein band 4.1) The peptide sequence was selected from the N terminal of EPB41. Peptide sequence SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD.
85 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Q4VB86
4.1RBand 4.1, E41P, EL1, EPB4.1, erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked), erythrocyte surface protein band 4.1, HE, P4.1, protein 4.1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
2035
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit