EphA8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310674100UL

Catalog No. NB126249

Description

EphA8 Polyclonal specifically detects EphA8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EphA8
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EEK, EK3, EPH- and ELK-related kinase, EPH- and ELK-related tyrosine kinase, EPH receptor A8, EPH-like kinase 3, ephrin type-A receptor 8, HEK3, hydroxyaryl-protein kinase, KIAA1459, protein-tyrosine kinase, tyrosine-protein kinase receptor EEK, tyrosylprotein kinase
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EphA8 (NP_001006944). Peptide sequence YKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAE
• Quantity: 100 μg
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 2046
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified