Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EphB1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP255594 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255594 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP255594 Supplier Novus Biologicals Supplier No. NBP255594

Rabbit Polyclonal Antibody

EphB1 Polyclonal specifically detects EphB1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen EphB1
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.10, EC 2.7.10.1, EK6, ELK, EPH receptor B1, eph tyrosine kinase 2, EphB1, EPH-like kinase 6, ephrin type-B receptor 1, EPHT2FLJ37986, hEK6, NETHek6, soluble EPHB1 variant 1, Tyrosine-protein kinase receptor EPH-2
Gene Symbols EPHB1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNE
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Growth and Development, Neuronal Cell Markers, Neuroscience, Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 2047
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.