Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Ephrin-A1 Antibody (CL6501), Novus Biologicals™
SDP

Catalog No. NB392753 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392753 25 μL
NBP276497 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB392753 Supplier Novus Biologicals Supplier No. NBP27649725UL
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Ephrin-A1 Monoclonal specifically detects Ephrin-A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Ephrin-A1
Applications Western Blot
Classification Monoclonal
Clone CL6501
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias ECKLG, EFL1, EPH-related receptor tyrosine kinase ligand 1, ephrin-A1, EPLG1TNF alpha-induced protein 4, Immediate early response protein B61, LERK1LERK-1, ligand of eph-related kinase 1, TNFAIP4B61, Tumor necrosis factor alpha-induced protein 4, tumor necrosis factor, alpha-induced protein 4
Gene Symbols EFNA1
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEK
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1942
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.