Ephrin-A1 Antibody (CL6501), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP27649725UL

Catalog No. NB392753

Description

Ephrin-A1 Monoclonal specifically detects Ephrin-A1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Ephrin-A1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: EFNA1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEK
• Regulatory Status: RUO
• Gene ID (Entrez): 1942
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Clone: CL6501
• Dilution: Western Blot 1 μg/mL
• Gene Alias: ECKLG, EFL1, EPH-related receptor tyrosine kinase ligand 1, ephrin-A1, EPLG1TNF alpha-induced protein 4, Immediate early response protein B61, LERK1LERK-1, ligand of eph-related kinase 1, TNFAIP4B61, Tumor necrosis factor alpha-induced protein 4, tumor necrosis factor, alpha-induced protein 4
• Host Species: Mouse
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1